Question Details

(Solved) I need summary. read this one. thank you Learning and Individual Differences journal homepage:elsevier.


I need summary. read this one.

thank you




Learning and Individual Differences

journal homepage: www.elsevier.com/locate/lindif

motivational orientation associated with academic self-efficacy that makes it a robust predictor of academic achievement and this motivational component needs further examination.

1.2. Self-efficacy and self-regulation

Someinsightintothepotentialself-regulatorymechanismsthatlink self-efficacy and performance is offered by Pintrich, Smith, Garcia, and McKeachie's(1993)comprehensivesocial-cognitiveframeworkasitincludes motivational components, cognitive and metacognitive strategies, as well as resource management strategies. For instance, high self-efficacy students who tend to be more persistent, hard working, opt for difficult tasks, and manage their anxiety are also more likely to utilize self-regulating processes such as goal setting, self-evaluation, and self-monitoring (Zimmerman, 2000). Similarly, Kennett and Keefer (2006) noted that self-confident students tend to display greater selfcontrol,workharderwhenfacingfailure,preferlearninggoals,andobtain better grades. Perhaps students with greater self-efficacy perform at a higher level because they can cope more effectively with cognitive demands (Lane & Lane, 2001), pursue a mastery goal orientation (Hsieh, Sullivan, & Guerra, 2007), perceive their learning tasks to be interesting and valuable, and utilize meaningful learning strategies (Greene, Miller, Crownson, Duke, & Akey, 2004). Thus, self-efficacy appears to be linked indirectlytoacademicachievementthroughgoalsettingoreffortregulation strategies that serve as a crucial internal resource (Bandura, 1997; Pajares, 1996;Pintrich, 1999). More specifically, self-efficacy is likely enhanced when selfregulated learners actively manage their internal and external environment by following a scheduled timetable for study and review, clarifying intentions to achieve, determining the level of effort needed, and knowing whom to ask for help (Pintrich, 2004). Highly self-regulated students also engage in increased effort by completing supplemental problems, completing extra work via online tutorials, achieving mastery over the material, and giving up avoidance behavior (Abara & Lokena, 2010). The importance of self-efficacy becomes more salient when considering procrastinators who perform poorly not because they lack knowledge of useful strategies but because theylacktheconfidencetoapplythesestrategiesinstartingandcompleting tasks (Klassen, Krawchuk, & Rajani, 2008). Implementing metacognitive skills to monitor and adjust effort seems to increase in importance as junior and senior level students begin enrolling in challenging courses (Lynch, 2006). Consequently, coaching students to develop self-regulating learning strategies appears to be an effective mechanism for improving self-efficacy, motivation, and performance (Tuckman, 2003).

1.3. Self-efficacy, implicit theories of intelligence, goals, and performance

According to social-cognitive theory, self-efficacy beliefs function within a broader framework of selftheories that determinemotivation as well as performance. Dweck (1999) proposed children's implicit theories about their intelligence influence feelings of self-efficacy, the goals they pursue, their level of self-regulation, and their academic achievement. For instance, entity theorists, who believe that intelligence is fixed and determined by innate ability, tend to put forth less effort; incremental theorists who believe that intelligence is malleable and determined by effort, tend to work hard. Such implicit assumptions about intelligence also influence academic goal orientation (Grant & Dweck, 2003) and motivation (Blackwell, Trzesniewski, & Dweck, 2007). For instance, entity theorists'belief in stable knowledge makes them less likely to adopt mastery goals (Braten & Stromso, 2004), less likely to utilize cognitive and metacognitive strategies such as elaborating, planning, and monitoring (Dahl, Bals, & Turi, 2005), more likely to quit in the face of difficulties (Zuckerman, Gagne, & Nafshi, 2006),and morelikelyto feelthreatened bydemands for more effort as cues of a lack of ability (Baird, Scott, Dearing, &

Hamill, 2009). In contrast, when faced with difficult tasks, incremental theorists are more likely to remain positive, seek mastery, increase effort,and mobilizeself-regulating strategies(Robins & Pals, 2002).Incremental theorists also tend to have high self-efficacy, display higher motivation,makegreater useof metacognitive strategiesof concentration, and engage in less self-handicapping (Ommundsen, Haugen, & Thorleif, 2005). However, despite the verification that self-efficacy beliefs are associated with self-regulating strategies, there appears to be some inconsistency in the findings regarding goals, motivation, and achievement. For instance, Pintrich (2000) suggests that a strong pursuit of both masteryandperformancegoalsisasadaptiveaspursuingonlymastery goals with reference to motivation, affect, thoughts, and achievement. Students also appear to customize the strategies they adopt when self-regulating their motivation and persistence at a task. For instance, when faced with a task that emphasizes performance outcomes they might use performance goals, when encountering difficult material they might use information processing strategies, and when trying to stay focused on material that is perceived to be irrelevant they might use extrinsic contingencies (Wolters, 1998). Thus, the complex ways in which self-regulation strategies, implicit theories of intelligence, and achievement goals are linked to the relationship between selfefficacy and academic performance demand further research. Our research attempts to fill this fundamental gap in the literature.

1.4. Rationale for the current studies

Previous researchers suggest that students who are motivated are likely to put forth greater effort; those who are confident are likely to persist; those who are less anxious are likely to be less distracted; those who practice effective cognitive and metacognitive strategies are likely to learn and recall effectively; those who believe they can change their intelligence develop a belief that they have the skills needed to perform; and those who manage their resources strategically are likely to be more efficient; together, all of these qualities are likely to lead to higher academic achievement. Based on prior research and a social-cognitive framework, we predicted that:

Hypothesis1. Studentswhohavehighself-efficacyaremorelikelyto subscribe to an incremental theory of intelligence compared to students with low self-efficacy (who are more likely to subscribe to an entity theory).

Hypothesis 2. Students who have high self-efficacy will prefer learning/mastery goals relative to students with low self-efficacy.

Hypothesis 3. Students who are highly motivated, confident that they can succeed (intrinsic, extrinsic, and task value, control of learning and self-efficacy,low test anxiety), havewell developed cognitive and metacognitive strategies (rehearsal, elaboration, organization, critical thinking, and self-regulation), and make effective use of their resources (time and study environment, effort regulation, peer learning, and help seeking) will report a higher grade point average (GPA).

2. Method

2.1. Participants

Our sample for Study 1 included 407 undergraduate students recruited from the Introduction to Psychology subject pool for course credit and from undergraduate psychology courses for extra credit. Participants from the subject pool completed the survey in small groups of about 8–10 students and participants from the undergraduate courses completed the surveys at home and returned them duringthenextclassmeeting.Thesampleincluded48.4%men,aswellas

68 M. Komarraju, D. Nadler / Learning and Individual Differences 25 (2013) 67–72

51.8% freshmen, 12.3% sophomores, 17.4% juniors and 18.2% seniors. In termsofrace/ethnicity,themajorityof participantswere European American (65.8%) and African American (22.6%), and 11.2% included all other ethnic groups. Participants had a mean age of 20.48 years and their majors were represented by Liberal Arts (29.2%), Science (11.5%), Business Administration (9.1%), Education (8.8%), Applied Sciences and Arts (7.1%), and Mass Communication and Media Arts (5.2%). For Study 2, we included a subset of the sample (N=257) from Study 1, as only these participants provided additional information regarding their current college grade point average (GPA).

2.2. Measures

Oursurveyincludedthefollowingthreemeasures.The81-item,Motivated Strategies for Learning Questionnaire (MSLQ; Pintrich, Smith, Garcia & McKeachie, 1991), assessed motivational orientations (intrinsic,extrinsic,andtaskvalue,controloflearning,self-efficacyforlearning and performance, and test anxiety), cognitive and metacognitive learning strategies (rehearsal, elaboration, organization, critical thinking, and self-regulation), and resource management strategies (time and study environment, effort regulation, peer learning, and help seeking). All items used a 7-point rating scale (1 = not at all true of me, to 7 = very true of me). The internal consistency Cronbach's alpha values were .70 and above for all the 15 subscales except four (intrinsic motivation .61, control of learning .58, rehearsal .61, and help-seeking .61). Of the latter, only help-seeking was a significant predictor and any conclusions regarding it are to be viewed with caution. The survey also included the 8-item, Implicit Theories of Intelligence Scale (Grant & Dweck, 2003), with sample items for entity theory, “Your intelligence is something about you which you can't change very much” and for incremental theory, “You can change even your basic intelligence level considerably”, and internal consistency coefficient values of .88 (entity) and .89 (incremental). Finally, an 18-item, Achievement Goal Inventory assessed achievement, normative, and mastery goals with alpha values ranging from .89 to .94 (Grant & Dweck, 2003) with sample items for achievement goals, “A major goal I have in my courses is to perform really well,” normative goals, “A major goal I have in my courses is to get higher grades than the other students,” and mastery goals, “In my classes I focus on developing my abilities and acquiring new ones.”

3. Results

3.1. Multivariate analysis of covariance, study 1

InStudy1,wetestedHypothesis1andHypothesis2,byconducting amultivariateanalysisofcovariance(MANCOVA)todeterminewhetherstudentsinhighandlowself-efficacygroupsdifferedsignificantlyin terms of implicit theories of intelligence and academic goals, while controlling for gender and age (see Table 1). We used a mean split on self-efficacy with the high self-efficacy group scoring above the mean (N=214) and the low self-efficacy group scoring below the mean (N=190). We found significant differences between the high self-efficacy and low self-efficacy groups, after controlling for participants age and gender, partial η2=.19, Pillai's Trace=0.19, F(8, 390)=11.383, pb.001. Gender, partial η2=.06,F(8, 390)=3.16, p=.002,andage,partialη2=.06,F(8,390)=3.21,p=.002,weresignificant covariates of implicit theories of intelligence and academic goals. Univariate ANOVAs revealed significant differences between the two self-efficacy groups on entity theory of intelligence and various goals (achievement outcome, achievement ability, normative outcome, learning, andmastery). Specifically, the low self-efficacy group (M=2.71, SD=1.09) scored significantly higher than the high self-efficacy group (M=2.48, SD=1.11) on entity theory of intelligence, partial η2=.01, F(1, 397)=4.95, p=.027. Further, the high self-efficacy group scored

significantlyhigherthanthelowself-efficacygrouponachievementoutcome goals, partial η2=.07, F(1, 397)=30.77, pb.001, on achievement abilitygoals,partialη2=.02,F(1,397)=9.55,p=.002,onnormativeoutcome goals, partial η2=.03, F(1, 397)=13.22, pb.001, learning goals, partial η2=.13, F(1, 397)=57.26, pb.001, and mastery goals, partial η2=.12, F(1,397)=52.06, pb.001.

3.2. Correlation analyses, study 2

In Study 2, we tested Hypothesis 3, by conducting correlation analyses for a subset of the participants who provided their grade point average (N=257, from the overall sample). We found several significant relationships between GPA and the subscales of the MSLQ (see Table 2). Most noteworthy, college GPA was positively correlated with task value, control of learning beliefs, self-efficacy, rehearsal strategies, self-regulation, time management, and effort regulation; and negatively with test anxiety.

3.3. Regression analyses, study 2

For testing Hypothesis 3 further, and for obtaining a more parsimonious and meaningful understanding of the pattern of significant correlations, we conducted hierarchical regression analyses using the stepwise entering method for each block or set of variables (see Table 3). In block one, we entered the subgroup of motivation variables, in block two we entered cognitive and metacognitive learning strategies, and finally in block three we entered resource management strategies, to predict college GPA. From the first subgroup of motivation variables, self-efficacy was the only variable that significantly predicted college GPA, β=.30, b=.20, t(254)=4.95, pb.001. From the second subgroup of cognitive and metacognitive learning strategies there were no incremental significant predictors. Finally, fromthethirdand finalsubgroupofresourcemanagementstrategies, both effort regulation, β=.32, b=.17, t(254)=4.76, pb.001, and help-seeking, β=−.15, b=−.07, t(254)=−2.51, pb.013 emerged as significant predictors of incremental variance in GPA.

3.4. Mediation analyses

As we sought a more thorough understanding of the mechanisms by which self-efficacy predicts GPA, we drew on prior research and testedeffortregulationasamediator,andfoundsupportforitspartial mediation of this relationship (Baron & Kenny, 1986). In testing for

Table 1 Multivariate Analysis of Covariance (MANCOVA) for differences between high and low self-efficacy groups in theories of intelligence and academic goals (N=407). Variable Self-efficacy group M SD F Partial η2 Entity Low 2.72 1.05 4.95⁎ .01 High 2.48 1.11 Incremental Low 4.29 0.99 3.34⁎⁎ .01 High 4.48 1.12 Achievement outcome Low 5.50 0.71 30.77⁎⁎⁎ .07 High 5.82 0.45 Achievement ability Low 4.47 1.23 9.55⁎⁎⁎ .02 High 4.83 1.24 Normative outcome Low 4.13 1.26 13.22⁎⁎⁎ .03 High 4.58 1.37 Normative ability Low 3.13 1.28 .60 .00 High 3.24 1.49 Learning Low 4.74 0.93 57.26⁎⁎⁎ .13 High 5.37 0.74 Challenge mastery Low 3.62 1.19 52.06⁎⁎⁎ .12 High 4.47 1.17 Note. ⁎ pb.05. ⁎⁎ pb.01. ⁎⁎⁎ pb.001.

69M. Komarraju, D. Nadler / Learning and Individual Differences 25 (2013) 67 –72

mediation, we found a significant relationship between self-efficacy and academic performance as measured by GPA, β=.30, b=.20, t(254)=4.95, pb.001andbetweenself-efficacyandeffortregulation, β=.50, b=.63, t(404)=11.66, pb.001; see Fig. 1. Further, there was a significant relationship between effort regulation and GPA, β=.32, b=.17, t(254)=4.76, pb.001. When accounting for effort regulation, therelationshipbetweenself-efficacyandacademicperformancewas reduced from β=.30 to β=.14, b=.09, t(254)=2.06, p=.041, indicating that effort regulation partially mediated the relationship between self-efficacy and GPA. A significant Sobel Test (pb.001) supported effort regulation as a partial mediator of the relationship between self-efficacy and academic performance.

4. Discussion

Ourresultsestablishthatstudentswhohavehighself-efficacyand confidence in their academic performance are also more likely to believe that intelligence is changeable and determined by effort. We believe these findings are important and encouraging because they dovetail with prior empirical evidence suggesting that students' self-efficacy can be improved and developed (Bandura, 1989). Thus, training students to strengthen their self-efficacy and their belief that they have the ability to determine their performance can

facilitate valuing effort and hard work. Our results also indicate that self-confident students are more likely to prefer academic goals such as seeking challenge and new knowledge as well as getting goodgrades,outperformingotherstudents,andshowingtheirintelligence through their schoolwork. In contrast, students who have lower self-efficacy and are unsure and insecure about their success incollege,aremorelikelytoassumethatintelligenceisa fixed,innate entity that cannot be changed and are less likely to be motivated by either performance or mastery goals. These findings highlight the intricate associations between students' self-efficacy, implicit beliefs about valuing effort, and pursuing a mastery orientation. We also found self-efficacy expectancies to be important in predicting academic achievement. Students who are more confident and self-assured are more likely to report higher levels of academic performance. In particular, self-efficacy appears to serve an essential function by facilitating the use of various metacognitive strategies andresourcesthatarecrucialforacademicperformance.Forinstance, students who exert effort regulation and persist when encountering courseworkthatmaybedifficultorboringaremorelikelytoperform well academically. Such students are likely to be more self-motivated and less likely to seek help from peers or instructors. Further, partial mediation analyses indicate that students with high self-efficacy are more apt to achieve higher grades because they are better able to control their natural impulses when studying material that is challenging, or when they feel lazy and distracted. Self-assured students

Table 2 Intercorrelations between GPA and subscales of the MSLQ: motivational orientations, cognitive–metacognitive strategies, and resource management (N=257).

Variable 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1. GPA –

Motivational orientations 2. Intrinsic .11 – 3. Extrinsic .05 .27⁎⁎ – 4. Task value .13⁎ .57⁎⁎ .30⁎⁎ – 5. Control learning .14⁎ .41⁎⁎ .23⁎⁎ .39⁎⁎ – 6. Self-efficacy .30⁎⁎ .53⁎⁎ .36⁎⁎ .53⁎⁎ .35⁎⁎ – 7. Test anxiety −.17⁎⁎ −.02 .21⁎⁎ −.01 .01 −.28⁎⁎ –

Cognitive–metacognitive 8. Rehearsal .19⁎⁎ .26⁎⁎ .38⁎⁎ .35⁎⁎ .17⁎⁎ .29⁎⁎ .13⁎ – 9. Elaboration .09 .41⁎⁎ .22⁎⁎ .49⁎⁎ .18⁎⁎ .42⁎⁎ −.07 .46⁎⁎ – 10. Organization .11 .31⁎⁎ .27⁎⁎ .29⁎⁎ .07 .27⁎⁎ .14⁎ .53⁎⁎ .51⁎⁎ – 11. Critical thinking −.02 .46⁎⁎ .15⁎⁎ .32⁎⁎ .23⁎⁎ .32⁎⁎ .01 .25⁎⁎ .56⁎⁎ .34⁎⁎ – 12. Self-regulation .14⁎ .51⁎⁎ .19⁎⁎ .38⁎⁎ .20⁎⁎ .48⁎⁎ −.07 .47⁎⁎ .65⁎⁎ .52⁎⁎ .62⁎⁎ –

Resource management 13. Time & study .31⁎⁎ .33⁎⁎ .25⁎⁎ .37⁎⁎ .20⁎⁎ .44⁎⁎ −.11⁎ .50⁎⁎ .38⁎⁎ .40⁎⁎ .21⁎⁎ .51⁎⁎ – 14. Effort regulation .39⁎⁎ .39⁎⁎ .22⁎⁎ .44⁎⁎ .18⁎⁎ .50⁎⁎ −.23⁎⁎ .40⁎⁎ .38⁎⁎ .30⁎⁎ .18⁎⁎ .47⁎⁎ .66⁎⁎ – 15. Peer learning −.01 .28⁎⁎ .20⁎⁎ .12⁎⁎ .05 .25⁎⁎ .10⁎ .29⁎⁎ .31⁎⁎ .30⁎⁎ .33⁎⁎ .39⁎⁎ .14⁎⁎ .08 – 16. Help seeking −.06 .17⁎⁎ .15⁎⁎ .22⁎⁎ −.05 .24⁎⁎ .06 .26⁎⁎ .30⁎⁎ .19⁎⁎ .18⁎⁎ .36⁎⁎ .21⁎⁎ 14⁎⁎ .56⁎⁎ – Note. ⁎ pb.05. ⁎⁎ pb.01.

Table 3 Summary of hierarchical regression analysis for motivational orientations, cognitive– metacognitive strategies, and resource management strategies predicting GPA (N= 257).

Outcome Step Variable B SE B β R2 Adjusted R2 College GPA 1 Self efficacy .20 .04 .30⁎⁎⁎ .09 .08 2 Self efficacy .09 .05 .14⁎ Effort regulation .17 .04 .32⁎⁎⁎ .16 .16 3 Self-efficacy .12 .05 .17⁎⁎ Effort regulation .17 .03 .32⁎⁎⁎ Help seeking −.07 .03 −.15⁎⁎ .18 .17 Note. ⁎ pb.05. ⁎⁎ pb.01. ⁎⁎⁎ pb.001.

Effort regulation

.296 (reduced to .137 with mediator)

.317.501

Self-Efficacy GPA

Fig. 1. Mediation analyses showing effort regulation partially mediating the relationship between self-efficacy and GPA.

70 M. Komarraju, D. Nadler / Learning and Individual Differences 25 (2013) 67–72

appear to maintain self-discipline, sustain their motivation and regulate their efforts during the most difficult times, especially when it is easier to quit. Thus, having high self-efficacy facilitates the ability to exert self-control and persist and obtain a higher GPA. The importance of effort regulation is supported by some prior research that identify related mechanisms such as the Big Five personality trait of conscientiousness (Conard, 2006), as well as academic discipline, degree commitment, and emotional control (Robbins, Allen, Casillas, Peterson, & Le, 2006) as predictors of academic achievement, after controlling for cognitive ability. Thus, self-efficacy emerges as a critical internal resource that has the potential for facilitating selfdisciplined behavior and enabling students to remain focused while successfully completing their work.

5. Implications, future research, conclusions

Our findings have broad implications for educators, coaches, and administrators. For instance, when planning their syllabi and designing classroom activities, instructors could develop students' selfefficacy by incorporating strategies based on Bandura's (1989) four sourcesofself-efficacy:masteryexperiences,modeling,socialpersuasion, and managing physiological arousal. Instructors could provide students with opportunities to experience success, observe high achieving role models, rehearse strategies for managing obstacles, and practice tactics for managing performance anxiety. Establishing opportunities that are easy to access and allow for students to experience success are likely to develop and enhance students' academic self-efficacy. Also, providing students with specific instances of role models (such as exceptional students who have performed well in the past or providing examples of expected behavior) is likely to haveapositiveinfluenceontheirself-beliefsaboutabilityandperformance. Finally, providing students with support and tools for managing stressful situations can be an invaluable resource for advancing students' self-efficacy and motivation to achieve higher levels of learning and performance. Instructors could also educate students in time management techniques and coach them on self-reflection andself-regulationofeffort.Perhapsclassroominstructorscandevise strategies to help students set goals that focus on mastery and encourage the use of self-regulatory strategies for persisting through difficult and challenging assignments. Instructors who emphasize the practical value of the material that is being learned and the importance of effort are likely to strengthen students' motivational beliefs (Zusho & Pintrich, 2003). Further, providing students with clear examples of passing work, clarifying expectations, and giving ample feedback are all likely to provide scaffolding for students' attempts and help them develop self-efficacy (Lane & Lane, 2001). Taken together, the results of our studies offer support for the essentialrole of self-efficacyand effort regulation in predicting academic achievement. Yet, we acknowledge that future researchers could implement several improvements. For example, we used self-reported GPA to assess academic performance. Although Noftle and Robins (2007) report a strong positive correlation between self-reported and official GPA, and Anaya (1999) reports strong positive correlations and higher accuracy between self-reported and actual scores on the Graduate Record Exam for students from selective universities and with higher scores, we acknowledge the limitations of using selfreport scores and recommend obtaining students' consent and accessing GPAs from official records so as to reduce potential inflation error. Future researchers can also extend our work by conducting experimentalor longitudinal studies thatwould permit causalinferences betweenmotivationalorientations,cognitiveandmetacognitivestrategies, self-beliefs, and performance. However, the results of our study makeanimportantcontributiontothe fieldbyinvestigatingacomplex set of predictors, documenting the importance of implicit theories of intelligence and achievement goals, and establishing the central

role of self-efficacy and effort regulation in predicting academic achievement.

References

Abara, B., & Lokena, E. (2010). Self-regulated learning and self-directed study in a pre-college sample. Learning and Individual Differences, 20, 25 –29. Anaya, G. (1999). Accuracy of self-reported test scores. College and University, 75, 13–19. Baird, G. L., Scott, W. D., Dearing, E., & Hamill, S. K. (2009). Cognitive self-regulation in youth with and without learning disabilities: Academic self-efficacy, theories of intelligence, learning vs. performance goal preferences, and effort attributions. Journal of Social and Clinical Psychology, 28, 881–908. Bandura,A.(1989).Humanagencyinsocialcognitivetheory.AmericanPsychologist,44, 1175–1184. Bandura, A. (1997). Self-efficacy: The exercise of self control. New York, NY: W.H. Freeman. Bandura, A. (2001). Social cognitive theory: An agentive perspective. Annual Review of Psychology, 52,1 –26. Bandura, A., & Locke, E. A. (2003). Negative self-efficacy and goal effects revision. Journal of Applied Psychology, 88, 87 –99. Baron,R.M.,&Kenny,D.A.(1986).Themoderator–mediatorvariabledistinctioninsocial psychological research: Conceptual, strategic and statistical considerations. Journal of Personality and Social Psychology, 51, 1173–1182. Blackwell, L. S., Trzesniewski, K. H., & Dweck, C. S. (2007). Implicit theories of intelligence predict achievement across an adolescent transition: A longitudinal study and an intervention. Child Development, 78, 246–263. Braten, I., & Stromso, H. I. (2004). Epistemological beliefs and implicit theories of intelligence as predictors of achievement goals. Contemporary Educational Psychology, 29, 371–388. Brown, S. D., Tramayne, S., Hoxha, D., Telander, K., Fan, X., & Lent, R. W. (2008). Social cognitive predictors of college students' academic performance and persistence: A meta-analytic path analysis. Journal of Vocational Behavior, 72, 298–308. Chemers, M. M., Hu, L., & Garcia, B. F. (2001). Academic self-efficacy and first-year college student performance and adjustment. Journal of Educational Psychology, 93, 55–64. Conard, M. A. (2006). Aptitude is not enough: How personality and behavior predict academic performance. Journal of Research in Personality, 40, 339–346. Dahl, T. I., Bals, M., & Turi, A. L. (2005). Are students' beliefs about knowledge and learning associated with their reported use of learning strategies? British Journal of Educational Psychology, 75, 257–273. Dweck, C. S. (1999). Self-theories: Their role in motivation, personality, and development. Philadelphia, PA: The Psychology Press. Gore, P. A. (2006). Academic self-efficacy as a predictor of college outcomes: Two incremental validity studies. Journal of Career Assessment, 14, 92 –115. Grant, H., & Dweck, C. S. (2003). Clarifying achievement goals and their impact. Journal of Personality and Social Psychology, 85, 541–553. Greene, B. A., Miller, R. B., Crownson, M., Duke, B. L., & Akey, K. L. (2004). Predicting high school students' cognitive engagement and achievement: Contributions of classroom perceptions and motivation. Contemporary Educational Psychology, 29, 462–482. Hsieh, P., Sullivan, J. R., & Guerra, N. S. (2007). A closer look at college students: Self-efficacy and goal orientation. Journal of Advanced Academics, 18, 454–476. Kennett, D. J., & Keefer, K. (2006). Impact of learned resourcefulness and theories of intelligence on academic achievement of university students: An integrated approach. Educational Psychology, 26, 441–457. Klassen, R. M., Krawchuk, L. L., & Rajani, S. (2008). Academic procrastination of undergraduates:Low self-efficacyto self-regulate predicts higher levelsof procrastination. Contemporary Educational Psychology, 33, 915–931. Kornilova, T. V., Kornilov, S. A., & Chumakova, M. A. (2009). Subjective evaluations of intelligence and academic self-concept predict academic achievement: Evidence from a selective student population. Learning and Individual Differences, 19, 596–608. Lane, A., & Lane, L. (2001). Self-efficacy and academic performance. Social Behavior and Personality: An International Journal, 29, 687–693. Lynch, D. J. (2006). Motivational factors, learning strategies and resource management as predictors of course grades. College Student Journal, 40, 423–428. Multon, K. D., Brown, S. D., & Lent, R. W. (1991). Relation of self-efficacy beliefs to academic outcomes: A meta-analytic investigation. Journal of Counseling Psychology, 38, 30 –38. Noftle, E. E., & Robins, R. W. (2007). Personality predictors of academic outcomes: Big five correlates of GPA and SAT scores. Journal of Personality and Social Psychology, 93, 116–130. Ommundsen, Y., Haugen, R., & Thorleif, L. (2005). Academic self-concept, implicit theories of ability, and self-regulation strategies. Scandinavian Journal of Educational Research, 49, 461–474. Pajares, F. (1996). Self-efficacy beliefs in academic settings. Review of Educational Research, 66, 543–578. Pajares, F., & Johnson, M. J. (1996). Self-efficacy beliefs and the writing performance of entering high school students. Psychology in the Schools, 33, 163–175. Pintrich,P.R.(1999).Theroleofmotivationinpromotingandsustainingself-regulated learning. International Journal of Educational Research, 31, 459–470. Pintrich, P. (2000). Multiple goals, multiple pathways: The role of goal orientation in learning and achievement. Journal of Educational Psychology, 92, 544–555.

71M. Komarraju, D. Nadler / Learning and Individual Differences 25 (2013) 67 –72

Pintrich, P. R. (2004). A conceptual framework for assessing motivation and selfregulated learning incollege students. Educational Psychology Review,16,385–407. Pintrich,P.R.,Smith, D.A.F.,Garcia, T.,& McKeachie, W.J.(1991). Amanualfor theuse of the motivated strategies for learning questionnaire (MSLQ). Technical report no. 91-B-004. The Regents of the University of Michigan. Pintrich, P. R., Smith, D. A. F., Garcia, T., & McKeachie, W. J. (1993). Reliability and predictive validity of the motivated strategies for learning questionnaire (MSLQ). Educational and Psychological Measurement, 53, 801–813. Robbins,S.B.,Allen,J.,Casillas,A.,Peterson,C.H.,&Le,H.(2006).Unravelingthedifferential effects of motivational and skills, social, and self-management measures from traditional predictors of college outcomes. Journal of Educational Psychology, 98, 598–616. Robins, R. W., & Pals, J. L. (2002). Implicit self-theories in the academic domain: Implications for goalorientation, attributions, affect, andself-esteem change. Self and Identity, 1, 313–336. Schunk, D. H., & Pajares, F. (2002). The development of academic self-efficacy. In A. Wigfield, & J. S. Eccles (Eds.), A volume in the educational psychology series. (pp. 15–31)San Diego, CA: Academic Press.

Tuckman,B.W.(2003).Theeffectoflearningandmotivationstrategiestrainingoncollege students' achievement. Journal of College Student Development, 44, 430–437. Valentine,J.C.,DuBois,D.L.,&Cooper,H.(2004).Therelationbetweenself-beliefsandacademic achievement:A meta-analyticreview. EducationalPsychologist, 39, 111–133. Wolters, C. A. (1998). Self-regulated learning and college students' regulation of motivation. Journal of Educational Psychology, 90, 224–235. Zajacova, A., Lynch, S. M., & Espenshade, T. J. (2005).

 


Solution details:
STATUS
Answered
QUALITY
Approved
ANSWER RATING

This question was answered on: Sep 05, 2019

PRICE: $15

Solution~000200181877.zip (25.37 KB)

Buy this answer for only: $15

This attachment is locked

We have a ready expert answer for this paper which you can use for in-depth understanding, research editing or paraphrasing. You can buy it or order for a fresh, original and plagiarism-free copy from our tutoring website www.aceyourhomework.com (Deadline assured. Flexible pricing. TurnItIn Report provided)

Pay using PayPal (No PayPal account Required) or your credit card . All your purchases are securely protected by .
SiteLock

About this Question

STATUS

Answered

QUALITY

Approved

DATE ANSWERED

Sep 05, 2019

EXPERT

Tutor

ANSWER RATING

GET INSTANT HELP/h4>

We have top-notch tutors who can do your essay/homework for you at a reasonable cost and then you can simply use that essay as a template to build your own arguments.

You can also use these solutions:

  • As a reference for in-depth understanding of the subject.
  • As a source of ideas / reasoning for your own research (if properly referenced)
  • For editing and paraphrasing (check your institution's definition of plagiarism and recommended paraphrase).
This we believe is a better way of understanding a problem and makes use of the efficiency of time of the student.

NEW ASSIGNMENT HELP?

Order New Solution. Quick Turnaround

Click on the button below in order to Order for a New, Original and High-Quality Essay Solutions. New orders are original solutions and precise to your writing instruction requirements. Place a New Order using the button below.

WE GUARANTEE, THAT YOUR PAPER WILL BE WRITTEN FROM SCRATCH AND WITHIN YOUR SET DEADLINE.

Order Now